PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo32G0001300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 296aa    MW: 32901.7 Da    PI: 5.6281
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo32G0001300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+  ++++G g+W+t ++  g+ R++k+c++rw +yl
  Spipo32G0001300 16 KGSWTPAEDMRLIVHIHKHGHGNWRTLPQLAGLQRCGKSCRLRWMNYL 63
                     799*******************************************97 PP

2Myb_DNA-binding54.13.5e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Spipo32G0001300  69 RGNFTKEEEDTIINLHQMLGKK-WSKIASYLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.9951163IPR017930Myb domain
SuperFamilySSF466893.52E-3113110IPR009057Homeodomain-like
SMARTSM007171.2E-111565IPR001005SANT/Myb domain
PfamPF002496.0E-151663IPR001005SANT/Myb domain
CDDcd001678.72E-101863No hitNo description
PROSITE profilePS5129425.40664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2667118IPR009057Homeodomain-like
SMARTSM007178.2E-1568116IPR001005SANT/Myb domain
PfamPF002495.5E-1669114IPR001005SANT/Myb domain
CDDcd001673.43E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009866Biological Processinduced systemic resistance, ethylene mediated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0071732Biological Processcellular response to nitric oxide
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRGRAPCCE KVGLKKGSWT PAEDMRLIVH IHKHGHGNWR TLPQLAGLQR CGKSCRLRWM  60
NYLRPDIRRG NFTKEEEDTI INLHQMLGKK WSKIASYLPG RTDNEIKNVW NTHLKKRLGS  120
TEKNKEPPSS PSYHSSVSSC CQSGSVGSGV HRADEETSRV RPESSADDFV EIPTEASVPE  180
MWDAISSSAH DNATETDLSM FPELWDLFDE DSPSFNPDIE VDNKTWIAYL ERELDLPQTT  240
DAPAAVEDYV GAPDAEKGTR GGAMDAEIDP VATFFSKRPR SPSPFSLSVT DISIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911363.19e-77PREDICTED: myb-related protein Zm1-like
TrEMBLM0S9004e-73M0S900_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P18090_0011e-72(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56160.11e-66myb domain protein 72